Structure of PDB 7ot5 Chain q

Receptor sequence

>7ot5q (length=116) Species: 562 (Escherichia coli) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPIK

3D structure

PDB

7ot5 A switch from alpha-helical to beta-strand conformation during co-translational protein folding.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	q	M81 R92 R93	M80 R91 R92
BS02	rna	q	H14 Y23 G24 V25 G26 T28 R29 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 R109 K110 K114	H13 Y22 G23 V24 G25 T27 R28 Y85 R86 R89 H90 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 K113
BS03	MG	q	T20 I22 V25	T19 I21 V24

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links