Structure of PDB 7oif Chain q

Receptor sequence

>7oifq (length=116) Species: 562 (Escherichia coli)

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPIK

3D structure

• PDB: 7oif A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
• Chain: q
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	M81 R92 R93	M80 R91 R92
BS02	rna	q	K13 I17 Y23 G24 V25 G26 T28 R29 R87 R90 H91 P96 V97 R98 Q100 R101 T102 K103 N105 R107 T108 R109 K110 R113 K114	K12 I16 Y22 G23 V24 G25 T27 R28 R86 R89 H90 P95 V96 R97 Q99 R100 T101 K102 N104 R106 T107 R108 K109 R112 K113
BS03	MG	q	T20 I22 V25	T19 I21 V24

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 08:39:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oif', asym_id = 'q', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oif', asym_id='q', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003676,0003723,0003735,0005840,0006412', uniprot = '', pdbid = '7oif', asym_id = 'q'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003723,0003735,0005840,0006412', uniprot='', pdbid='7oif', asym_id='q')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>