Structure of PDB 7of3 Chain q |
>7of3q (length=128) Species: 9606 (Homo sapiens) [Search protein sequence] |
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGS LWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAEC MAKMPQMIVNWQQQQRENWEKAQADKER |
|
PDB | 7of3 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling. |
Chain | q |
Resolution | 2.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
q |
W50 R55 K59 |
W26 R31 K35 |
|
|
|
|