Structure of PDB 7odr Chain q |
>7odrq (length=141) Species: 9606 (Homo sapiens) [Search protein sequence] |
YRARPPPRRRPGPRWPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGS LWPSPEQLRELEAEEREWYPSLATMQESLRVKQLAEEQKRREREQHIAEC MAKMPQMIVNWQQQQRENWEKAQADKERRARLQAEAQELLG |
|
PDB | 7odr Stepwise maturation of the peptidyl transferase region of human mitoribosomes. |
Chain | q |
Resolution | 2.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
q |
R34 R38 W50 R55 |
R10 R14 W26 R31 |
|
|
|
|