Structure of PDB 7obq Chain q

Receptor sequence
>7obqq (length=104) Species: 9615 (Canis lupus familiaris) [Search protein sequence]
RFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLE
KNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIP
KLKT
3D structure
PDB7obq Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
Chainq
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q R14 F15 I16 C17 Y19 Y22 T28 I29 R33 P36 I37 K66 M67 S69 R70 R81 R101 R1 F2 I3 C4 Y6 Y9 T15 I16 R20 P23 I24 K53 M54 S56 R57 R68 R88
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7obq, PDBe:7obq, PDBj:7obq
PDBsum7obq
PubMed34260909
UniProtJ9PAS6|SRP19_CANLF Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]