Structure of PDB 7nvo Chain q

Receptor sequence
>7nvoq (length=352) Species: 9606 (Homo sapiens) [Search protein sequence]
EAVYRNIQACKELAQTTRTAYGPNGMNKMVINHLEKLFVTNDAATILREL
EVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLRIGLSVS
EVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNE
VFLAKLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHISTIVLR
GSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELAKQITSYGE
TCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNV
GLDIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAK
PA
3D structure
PDB7nvo Snapshots of actin and tubulin folding inside the TRiC chaperonin.
Chainq
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP q Y47 P49 D99 G100 T101 N102 T166 M169 S170 G412 I482 I497 D499 Y21 P23 D73 G74 T75 N76 T140 M143 S144 G234 I304 I319 D321
BS02 AF3 q D99 N102 D73 N76
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0044183 protein folding chaperone
GO:0045296 cadherin binding
GO:0051082 unfolded protein binding
GO:0140662 ATP-dependent protein folding chaperone
Biological Process
GO:0006457 protein folding
GO:0007339 binding of sperm to zona pellucida
GO:0032212 positive regulation of telomere maintenance via telomerase
GO:0050821 protein stabilization
GO:0051086 chaperone mediated protein folding independent of cofactor
GO:0061077 chaperone-mediated protein folding
GO:1904871 positive regulation of protein localization to Cajal body
GO:1904874 positive regulation of telomerase RNA localization to Cajal body
Cellular Component
GO:0002199 zona pellucida receptor complex
GO:0005576 extracellular region
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005813 centrosome
GO:0005829 cytosol
GO:0005832 chaperonin-containing T-complex
GO:0005856 cytoskeleton
GO:0005874 microtubule
GO:0005929 cilium
GO:0034774 secretory granule lumen
GO:0035578 azurophil granule lumen
GO:0044297 cell body
GO:0045111 intermediate filament cytoskeleton
GO:0070062 extracellular exosome
GO:1904813 ficolin-1-rich granule lumen

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nvo, PDBe:7nvo, PDBj:7nvo
PDBsum7nvo
PubMed35449234
UniProtP50990|TCPQ_HUMAN T-complex protein 1 subunit theta (Gene Name=CCT8)

[Back to BioLiP]