Structure of PDB 6ypu Chain q

Receptor sequence
>6ypuq (length=80) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQGQAEKL
RLDADRFAHWVSQGAQPSERVASLAAQAKK
3D structure
PDB6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Chainq
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q M1 V2 R5 L6 R8 G9 G10 K12 K13 F16 S24 R25 R28 G30 R31 Q44 Q46 Q63 G64 S68 R70 M1 V2 R5 L6 R8 G9 G10 K12 K13 F16 S24 R25 R28 G30 R31 Q44 Q46 Q63 G64 S68 R70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum6ypu
PubMed32857965
UniProtD0CCR5

[Back to BioLiP]