Structure of PDB 6qtz Chain q

Receptor sequence

>6qtzq (length=204) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQ
KIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIREF
PEYF

3D structure

PDB

6qtz Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	R4 P5 A6 R7 Y9 K13 N14 K15 P16 Y17 Y22 Y34 E63 A67 R90 H92 F94 R98 N100 M115 R116 G117 A118 W119 G120 Y157 K158 D193 G194 F196 K198	R3 P4 A5 R6 Y8 K12 N13 K14 P15 Y16 Y21 Y33 E62 A66 R89 H91 F93 R97 N99 M102 R103 G104 A105 W106 G107 Y144 K145 D180 G181 F183 K185
BS02	rna	q	Y11 L57 K202 K203 G204 L206	Y10 L56 K189 K190 G191 L193

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qtz, PDBe:6qtz, PDBj:6qtz
PDBsum	6qtz
PubMed	31115337
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]