Structure of PDB 6qt0 Chain q

Receptor sequence

>6qt0q (length=216) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYF

3D structure

PDB

6qt0 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	R4 A6 R7 R10 K13 N14 K15 P16 Y22 R24 Y34 S61 E63 A64 A67 R90 H92 F94 R98 N100 R110 M115 R116 A118 W119 Q133 Y157 K158 P160 D193 G194 F196	R3 A5 R6 R9 K12 N13 K14 P15 Y21 R23 Y33 S60 E62 A63 A66 R89 H91 F93 R97 N99 R109 M114 R115 A117 W118 Q132 Y156 K157 P159 D192 G193 F195
BS02	rna	q	Y11 E56 L57 I131 K202 G204 L206 N209	Y10 E55 L56 I130 K201 G203 L205 N208

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6qt0, PDBe:6qt0, PDBj:6qt0
PDBsum	6qt0
PubMed	31115337
UniProt	P41805\|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]