Structure of PDB 6n8o Chain q

Receptor sequence
>6n8oq (length=107) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
LKDVVTREYTINLHKRLHGVSFKKRAPRAVKEIKKFAKLHMGTDDVRLAP
ELNQAIWKRGVKGVEYRLRLRISRKRNEEEDAKNPLFSYVEPVLVASAKG
LQTVVVE
3D structure
PDB6n8o Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
Chainq
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q R10 T13 N15 H17 K18 H21 G22 S24 F25 K26 R28 K34 H43 L51 P53 N56 Q57 W60 V64 K65 R70 K102 Q105 T106 R7 T10 N12 H14 K15 H18 G19 S21 F22 K23 R25 K31 H40 L48 P50 N53 Q54 W57 V61 K62 R67 K99 Q102 T103
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006450 regulation of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n8o, PDBe:6n8o, PDBj:6n8o
PDBsum6n8o
PubMed30814529
UniProtP0C2H8|RL31A_YEAST Large ribosomal subunit protein eL31A (Gene Name=RPL31A)

[Back to BioLiP]