Structure of PDB 6n8j Chain q

Receptor sequence

>6n8jq (length=97) Species: 559292 (Saccharomyces cerevisiae S288C)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKK

3D structure

• PDB: 6n8j Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
• Chain: q
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	V2 N3 P5 K9 T10 Y11 K13 K15 H20 Y28 G31 K32 A33 F36 A37 Q38 G39 R41 R42 R45 K46 G49 G52 Q53 T54 K55 P56 V57 F58 H59 K60 A62 K63 T65 K67 V69 R71 R80 Q82 R87 C88 K89 K97 K98	V1 N2 P4 K8 T9 Y10 K12 K14 H19 Y27 G30 K31 A32 F35 A36 Q37 G38 R40 R41 R44 K45 G48 G51 Q52 T53 K54 P55 V56 F57 H58 K59 A61 K62 T64 K66 V68 R70 R79 Q81 R86 C87 K88 K96 K97

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n8j, PDBe:6n8j, PDBj:6n8j
• PDBsum: 6n8j
• PubMed: 30814529
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)