Structure of PDB 6dzi Chain q

Receptor sequence
>6dziq (length=131) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
TMTDPIADFLTRLRNANSAYHDEVTLPHSKLKANIAEILKREGYISDYRT
EDARVGKSLVVQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGL
GVAIISTSSGLLTDRQAARQGVGGEVLAYVW
3D structure
PDB6dzi Zinc depletion induces ribosome hibernation in mycobacteria.
Chainq
Resolution3.46 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q T2 M3 T4 D5 T12 R13 R15 N16 H22 K31 V56 K82 P83 R86 Y88 K90 R96 S107 T108 A119 V123 G124 E126 T1 M2 T3 D4 T11 R12 R14 N15 H21 K30 V55 K81 P82 R85 Y87 K89 R95 S106 T107 A118 V122 G123 E125
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dzi, PDBe:6dzi, PDBj:6dzi
PDBsum6dzi
PubMed30038002
UniProtA0QSG3|RS8_MYCS2 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]