Structure of PDB 5wf0 Chain q

Receptor sequence
>5wf0q (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB5wf0 Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
Chainq
Resolution3.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna q K3 R5 M16 E17 K18 R26 I32 Y33 K35 K38 R39 T40 T41 K42 H44 R64 P65 L66 S67 K68 K70 W72 K1 R3 M14 E15 K16 R24 I30 Y31 K33 K36 R37 T38 T39 K40 H42 R62 P63 L64 S65 K66 K68 W70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wf0, PDBe:5wf0, PDBj:5wf0
PDBsum5wf0
PubMed29733411
UniProtP0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]