Structure of PDB 3jct Chain q

Receptor sequence
>3jctq (length=183) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
QKVKLPSGIKLDVEKKDQIPEELLKKSTTSWSTASVRPSTLDIEPIAVKE
FTEIPHAGKSYNPNNKAWSELINKEYKEEKAREDERIALEKYKERIRHLM
ETLDDNKKHKLGTKYSVIDERLEIKFSDELSDSLRKLKPEGNLLYDTVRK
LQSSGKVETRVPVRKGRKYKQKITEKWTHKDFK
3D structure
PDB3jct Diverse roles of assembly factors revealed by structures of late nuclear pre-60S ribosomes
Chainq
Resolution3.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q K380 Y387 R432 P434 R436 K437 G438 R439 K440 Y441 I445 W449 K452 K108 Y115 R160 P162 R164 K165 G166 R167 K168 Y169 I173 W177 K180
BS02 rna q S193 T194 T195 S196 W197 S198 A200 S201 V202 S205 T206 K448 W449 S27 T28 T29 S30 W31 S32 A34 S35 V36 S39 T40 K176 W177
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3jct, PDBe:3jct, PDBj:3jct
PDBsum3jct
PubMed27251291
UniProtQ12080|NOP53_YEAST Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]