Structure of PDB 8ipb Chain pa

Receptor sequence

>8ipbpa (length=150) Species: 4565 (Triticum aestivum) [Search protein sequence]

GRMHSRGKGISSSALPYKRTPPSWVKTAVADVDELITKAAKKGQMPSQIG
VLLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKH
LERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESATASTLVA

3D structure

PDB

8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	pa	R3 M4 H5 K9 G10 I11 S12 S13 S14 A15 S48 R55 P61 L62 K64 K70 L72 R73 K76 E86 D87 F90 K94 I98 H101 N105 K107 D108 D110 F113 R114 L117 S120 R121 R124 Y128	R2 M3 H4 K8 G9 I10 S11 S12 S13 A14 S47 R54 P60 L61 K63 K69 L71 R72 K75 E85 D86 F89 K93 I97 H100 N104 K106 D107 D109 F112 R113 L116 S119 R120 R123 Y127
BS02	rna	pa	H123 K140	H122 K139

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
PDBsum	8ipb
PubMed	38267667
UniProt	Q5XUU9

[Back to BioLiP]