Structure of PDB 8ip9 Chain pa

Receptor sequence

>8ip9pa (length=150) Species: 4565 (Triticum aestivum) [Search protein sequence]

GRMHSRGKGISSSALPYKRTPPSWVKTAVADVDELITKAAKKGQMPSQIG
VLLRDQHGIPLVKSVTGSKILRILKAHGLAPEIPEDLYFLIKKAVAIRKH
LERNRKDKDSKFRLILVESRIHRLARYYKRTKKLPPTWKYESATASTLVA

3D structure

PDB

8ip9 Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	pa	G2 R3 M4 H5 R7 G8 K9 G10 I11 S12 S13 S14 A15 R20 P47 S48 G51 R55 L62 K64 K70 I71 L72 R73 D87 F90 K94 I98 H101 N105 K107 D108 D110 K112 F113 R114 I116 S120 R121 R124 R127 Y128	G1 R2 M3 H4 R6 G7 K8 G9 I10 S11 S12 S13 A14 R19 P46 S47 G50 R54 L61 K63 K69 I70 L71 R72 D86 F89 K93 I97 H100 N104 K106 D107 D109 K111 F112 R113 I115 S119 R120 R123 R126 Y127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ip9, PDBe:8ip9, PDBj:8ip9
PDBsum	8ip9
PubMed	38267667
UniProt	Q5XUU9

[Back to BioLiP]