Structure of PDB 5m1j Chain p5

Receptor sequence
>5m1jp5 (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB5m1j Structural insights into ribosomal rescue by Dom34 and Hbs1 at near-atomic resolution.
Chainp5
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p5 K28 R85 K27 R84
BS02 rna p5 A2 K3 R4 T5 K6 K7 V8 G9 I10 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 L22 Q33 H34 C42 K44 R49 A51 A52 Y69 A1 K2 R3 T4 K5 K6 V7 G8 I9 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 L21 Q32 H33 C41 K43 R48 A50 A51 Y68
BS03 ZN p5 C39 C42 C57 C38 C41 C56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5m1j, PDBe:5m1j, PDBj:5m1j
PDBsum5m1j
PubMed27995908
UniProtP0CX26|RL43B_YEAST Large ribosomal subunit protein eL43B (Gene Name=RPL43B)

[Back to BioLiP]