Structure of PDB 7oya Chain p1

Receptor sequence

>7oyap1 (length=91) Species: 7955 (Danio rerio) [Search protein sequence]

AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRKA
VGIWHCGSCMKTVAGGAWSYNTTSAVTVKSAIKRLKELKDQ

3D structure

PDB

7oya A molecular network of conserved factors keeps ribosomes dormant in the egg.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p1	A2 K3 R4 T5 K6 K7 V8 G9 G12 K13 Y14 G15 T16 R17 Y18 G19 A20 S21 L22 R23 H34 F41 C42 K44 K46 R49 A51 V52 G58 S59 K62 W69	A1 K2 R3 T4 K5 K6 V7 G8 G11 K12 Y13 G14 T15 R16 Y17 G18 A19 S20 L21 R22 H33 F40 C41 K43 K45 R48 A50 V51 G57 S58 K61 W68
BS02	ZN	p1	C39 C42	C38 C41

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

External links