Structure of PDB 4u3m Chain p0

Receptor sequence
>4u3mp0 (length=143) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
GIREKKAEYFAKLREYLEEYKSLFVVGVDNVSSQQMHEVRKELRGRAVVL
MGKNTMVRRAIRGFLSDLPDFEKLLPFVKGNVGFVFTNEPLTEIKNVIVS
NRVAAGLTVVQVYDNGQVFPSSILDITDEELVSHFVSAVSTIA
3D structure
PDB4u3m ?
Chainp0
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p0 R5 K8 F12 S34 S35 Q36 H39 R42 R46 L52 M53 K55 N56 T57 M58 R61 K81 G82 N83 R3 K6 F10 S32 S33 Q34 H37 R40 R44 L50 M51 K53 N54 T55 M56 R59 K79 G80 N81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4u3m, PDBe:4u3m, PDBj:4u3m
PDBsum4u3m
PubMed25209664
UniProtP05317|RLA0_YEAST Large ribosomal subunit protein uL10 (Gene Name=RPP0)

[Back to BioLiP]