Structure of PDB 8y39 Chain p

Receptor sequence

>8y39p (length=87) Species: 1280 (Staphylococcus aureus)

AVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIK
VDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQK

3D structure

• PDB: 8y39 Synthetic macrolides overcoming MLS B K-resistant pathogens.
• Chain: p
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	A2 V3 K4 R6 L7 R9 L10 S12 K13 R14 F17 Y18 R19 D24 A25 R26 R29 G31 R32 W60 D63 G64 K66 T68 T70 H72 N73 S76 K77 M81 K82 D85 K88	A1 V2 K3 R5 L6 R8 L9 S11 K12 R13 F16 Y17 R18 D23 A24 R25 R28 G30 R31 W59 D62 G63 K65 T67 T69 H71 N72 S75 K76 M80 K81 D84 K87

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8y39, PDBe:8y39, PDBj:8y39
• PDBsum: 8y39
• PubMed: 38992047
• UniProt: P66441|RS16_STAAW Small ribosomal subunit protein bS16 (Gene Name=rpsP)