Structure of PDB 8wib Chain p

Receptor sequence

>8wibp (length=88) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

ALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHH
SRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR

3D structure

• PDB: 8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: p
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	L56 L57 V60 R63 R64 R88 R89	L55 L56 V59 R62 R63 R87 R88
BS02	rna	p	K8 D21 T22 G23 Q28 R35 H42 H48 D49 H51 S52 R54 L58 R65 Y69	K7 D20 T21 G22 Q27 R34 H41 H47 D48 H50 S51 R53 L57 R64 Y68

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wib, PDBe:8wib, PDBj:8wib
• PDBsum: 8wib
• PubMed: 38245551
• UniProt: A0QVQ3|RS15_MYCS2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)