Structure of PDB 8ro1 Chain p |
>8ro1p (length=76) Species: 6239 (Caenorhabditis elegans) [Search protein sequence] |
HTIYVNNLNEKVKKDELKRSLHMVFTQFGEIIQLMSFRKEKMRGQAHIVF KEVSSASNALRALQGFPFYGKPMRIQ |
|
PDB | 8ro1 Mechanism for the initiation of spliceosome disassembly. |
Chain | p |
Resolution | 3.0 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
p |
E17 K20 R45 R50 |
E10 K13 R38 R43 |
|
|
|