Structure of PDB 8q5i Chain p

Receptor sequence

>8q5ip (length=232) Species: 5476 (Candida albicans)

NPLFESTPKNFGIGQSIQPKRNLSRFVKWPEYVRLQRQKKILSLRLKVPP
SIAQFSQTLDKNTAAQAFKLLNKYRPETSAEKKERLTKEAAAIAEGKTAK
DVSPKPVVVKYGLNHVVSLIENKKAKLVLIANDVDPIELVVFLPALCKKM
GVPYAIVKGKARLGTLVHKKTSAVAALTEVNSADEAELSKLISTINANYI
EKYEENRKHWGGGIMGSKANDKIAKKAKAAAA

3D structure

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Chain: p
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	E29 S30 T31 K33 N34 F35 G36 I37 G38 Q39 Q42 P43 R45 L47 S48 R49 F50 K52 E55 Y56 R58 R61 L66 R69 L70 E101 K106 R109 K124 S127 K129 P130 K134 Y135 G136 L137 N138 H139 S142 L143 K148 V158 D159 L163 K184 A185 K193 K194 T195 A197 M239 G240 S241 K242 A243 D245	E5 S6 T7 K9 N10 F11 G12 I13 G14 Q15 Q18 P19 R21 L23 S24 R25 F26 K28 E31 Y32 R34 R37 L42 R45 L46 E77 K82 R85 K100 S103 K105 P106 K110 Y111 G112 L113 N114 H115 S118 L119 K124 V134 D135 L139 K160 A161 K169 K170 T171 A173 M215 G216 S217 K218 A219 D221
BS02	rna	p	Y56 V57 Q60 R61 K64 K85 K182 R186	Y32 V33 Q36 R37 K40 K61 K158 R162

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: A0A8H6C337