Structure of PDB 8p2g Chain p

Receptor sequence
>8p2gp (length=86) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
ISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHHS
RRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIR
3D structure
PDB8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chainp
Resolution2.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p N40 L57 V60 N38 L55 V58
BS02 rna p Q5 K8 D21 T22 G23 Q28 H42 H46 K48 D49 H50 H51 S52 R54 K58 H65 Y69 Q3 K6 D19 T20 G21 Q26 H40 H44 K46 D47 H48 H49 S50 R52 K56 H63 Y67
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum8p2g
PubMed38902339
UniProtQ2G2Q1|RS15_STAA8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]