Structure of PDB 8i0v Chain p

Receptor sequence

>8i0vp (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]

PNHTIYINNMNDKIKKEELKRSLYALFSQFGHVVDIVALKTMKMRGQAFV
IFKELGSSTNALRQLQGFPFYGKPMRIQYAKTDSDIISKM

3D structure

PDB

8i0v Molecular basis for the activation of human spliceosome

Chain

Resolution

3.0 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	D16 K44 K47 R49	D12 K40 K43 R45

Gene Ontology

	Biological Process
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0001650	fibrillar center
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0016607	nuclear speck
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071013	catalytic step 2 spliceosome

External links

PDB	RCSB:8i0v, PDBe:8i0v, PDBj:8i0v
PDBsum	8i0v
PubMed	39068178
UniProt	P08579\|RU2B_HUMAN U2 small nuclear ribonucleoprotein B'' (Gene Name=SNRPB2)