Structure of PDB 8bh6 Chain p

Receptor sequence
>8bh6p (length=90) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIK
VDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chainp
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p A2 V3 R6 L7 L10 S12 K13 R14 F17 R19 D24 A25 R26 R29 D30 G31 R32 P42 D63 K66 T70 N73 K77 M81 D85 K89 A1 V2 R5 L6 L9 S11 K12 R13 F16 R18 D23 A24 R25 R28 D29 G30 R31 P41 D62 K65 T69 N72 K76 M80 D84 K88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FZ45|RS16_STAA8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]