Structure of PDB 8bgh Chain p

Receptor sequence
>8bghp (length=123) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA
3D structure
PDB8bgh Modulation of translational decoding by m 6 A modification of mRNA.
Chainp
Resolution2.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p R9 R12 A13 R14 K18 A26 C27 P28 Q29 R31 K44 N46 R50 E70 G84 K88 R110 K111 Q112 R114 S115 V119 K120 R121 R8 R11 A12 R13 K17 A25 C26 P27 Q28 R30 K43 N45 R49 E69 G83 K87 R109 K110 Q111 R113 S114 V118 K119 R120
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034336 misfolded RNA binding
Biological Process
GO:0000372 Group I intron splicing
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0033120 positive regulation of RNA splicing
GO:0034337 RNA folding
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bgh, PDBe:8bgh, PDBj:8bgh
PDBsum8bgh
PubMed37553384
UniProtP0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]