Structure of PDB 7uvv Chain p

Receptor sequence
>7uvvp (length=82) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
MVVIRLARGGAKKRPFYQIVVTDSRNARDGRFIERIGFFNPTAQGQAEKL
RLDADRFAHWVSQGAQPSERVASLAAQAKKAT
3D structure
PDB7uvv Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Chainp
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p M19 V20 R23 L24 G28 K30 K31 F34 R43 R46 G48 R49 R53 Q62 R69 Q81 S86 R88 S91 M1 V2 R5 L6 G10 K12 K13 F16 R25 R28 G30 R31 R35 Q44 R51 Q63 S68 R70 S73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvv, PDBe:7uvv, PDBj:7uvv
PDBsum7uvv
PubMed37192172
UniProtA0A1V3DIZ9

[Back to BioLiP]