Structure of PDB 7qiw Chain p

Receptor sequence

>7qiwp (length=99) Species: 4081 (Solanum lycopersicum)

VNVPKTKKTYCKSKECKKHTLHKVTQYKKGKDSLAAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKIVLRLQCQGCKHVSQHPIKRCKHFEIGGDKKGK

3D structure

• PDB: 7qiw Cryo-EM structure and rRNA modification sites of a plant ribosome.
• Chain: p
• Resolution: 2.35 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	Y43 K55 P56 F58	Y42 K54 P55 F57
BS02	rna	p	V2 N3 P5 K8 K9 Y11 K13 K19 H20 Y28 K30 G31 D33 S34 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G52 Q53 K55 P56 V57 F58 K60 A62 K63 T65 K66 K67 V69 R71 H79 V80 Q82 H83 P84 K86 C88 K89 K97 K98	V1 N2 P4 K7 K8 Y10 K12 K18 H19 Y27 K29 G30 D32 S33 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G51 Q52 K54 P55 V56 F57 K59 A61 K62 T64 K65 K66 V68 R70 H78 V79 Q81 H82 P83 K85 C87 K88 K96 K97
BS03	ZN	p	C12 C17 C74 C77	C11 C16 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qiw, PDBe:7qiw, PDBj:7qiw
• PDBsum: 7qiw
• PubMed: 35643637
• UniProt: A0A3Q7H1I0