Structure of PDB 7pjt Chain p

Receptor sequence
>7pjtp (length=82) Species: 562 (Escherichia coli) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB7pjt Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chainp
Resolution6.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p V2 R5 L6 R8 A11 K12 K13 R14 F16 S24 R25 A27 R28 G30 R31 F32 R35 F38 P41 I42 K46 R51 W60 S68 R70 V2 R5 L6 R8 A11 K12 K13 R14 F16 S24 R25 A27 R28 G30 R31 F32 R35 F38 P41 I42 K46 R51 W60 S68 R70
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pjt, PDBe:7pjt, PDBj:7pjt
PDBsum7pjt
PubMed34635670
UniProtC3SYP2

[Back to BioLiP]