Structure of PDB 7pau Chain p

Receptor sequence

>7paup (length=114) Species: 272634 (Mycoplasmoides pneumoniae M129)

MRIKGGKQTRVRRKKWLKQASGSFGTRHASYKVAKQTVIQAAKYAYRDRR
NKKRDFRSLWILRLNAALREQGMTYSVFINLLKKHNIEINRKVLSELAIK
EPSKFNLIVQKVKS

3D structure

• PDB: 7pau Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: p
• Resolution: 8.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	M1 R2 I3 K4 G5 G6 K7 Q8 T9 R10 R12 R13 K14 K18 G22 F24 G25 R27 H28 A29 S30 Y31 K32 Q36 Y44 Y46 R47 D48 R49 R50 K52 K53 R54 F56 R57 S58 W60 I61 L62 N65 R69 Y75 S76 I79 N80 K83 R91 K92	M1 R2 I3 K4 G5 G6 K7 Q8 T9 R10 R12 R13 K14 K18 G22 F24 G25 R27 H28 A29 S30 Y31 K32 Q36 Y44 Y46 R47 D48 R49 R50 K52 K53 R54 F56 R57 S58 W60 I61 L62 N65 R69 Y75 S76 I79 N80 K83 R91 K92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pau, PDBe:7pau, PDBj:7pau
• PDBsum: 7pau
• PubMed: 36171285
• UniProt: P78023|RL20_MYCPN Large ribosomal subunit protein bL20 (Gene Name=rplT)