Structure of PDB 7ow7 Chain p

Receptor sequence
>7ow7p (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]
KIRIFDLGRKKAKVDEFPLCGHMVSDEYEQLSSEALEAARICANKYMVKS
CGRDGFHMRVRLHPFHVITVARVHIGQVIMSIRTKLQNEEHVIEALRRAK
FKFPGRQKIHISKKWGFTKFNADEFEDMVAKKCLIPDGCGVKYVPSHGPL
DKWRVLHS
3D structure
PDB7ow7 Structure of human EIF6-bound large ribosomal subunit
Chainp
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p K30 F34 D35 K39 S61 E63 K74 R90 H92 F94 F157 K158 P160 K198 K1 F5 D6 K10 S32 E34 K45 R61 H63 F65 F101 K102 P104 K142
BS02 rna p Y57 I131 S202 H203 G204 P205 L206 W209 Y28 I75 S146 H147 G148 P149 L150 W153
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
GO:0007141 male meiosis I
GO:0007283 spermatogenesis
GO:0030154 cell differentiation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ow7, PDBe:7ow7, PDBj:7ow7
PDBsum7ow7
PubMed
UniProtQ96L21|RL10L_HUMAN Ribosomal protein uL16-like (Gene Name=RPL10L)

[Back to BioLiP]