Structure of PDB 7bgd Chain p

Receptor sequence
>7bgdp (length=90) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIK
VDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK
3D structure
PDB7bgd Stabilization of Ribosomal RNA of the Small Subunit by Spermidine in Staphylococcus aureus
Chainp
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p A2 K4 R6 L7 R9 G11 K13 R14 F17 Y18 R19 D24 R26 P28 R29 G31 R32 P42 W60 D63 G64 K66 T68 T70 H72 N73 S76 M81 K82 D85 K89 A1 K3 R5 L6 R8 G10 K12 R13 F16 Y17 R18 D23 R25 P27 R28 G30 R31 P41 W59 D62 G63 K65 T67 T69 H71 N72 S75 M80 K81 D84 K88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7bgd, PDBe:7bgd, PDBj:7bgd
PDBsum7bgd
PubMed
UniProtQ2FZ45|RS16_STAA8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]