Structure of PDB 7aqw Chain p |
>7aqwp (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] |
GRKKGLPEFEESAPDGFDPENPYKDPVAMVEMREHIVREKWIQIEKAKIL REKVKWCYRVEGVNHYQKCRHLVQQYLDSTRGVGWGKDHRPIS |
|
PDB | 7aqw A ferredoxin bridge connects the two arms of plant mitochondrial complex I. |
Chain | p |
Resolution | 3.17 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
p |
G2 R3 |
G1 R2 |
|
|
|
|