Structure of PDB 6zmw Chain p

Receptor sequence
>6zmwp (length=85) Species: 9606 (Homo sapiens) [Search protein sequence]
DYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPE
YGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
3D structure
PDB6zmw Structure of a human 48Stranslational initiation complex.
Chainp
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p R38 R41 K42 K61 K64 K65 A68 C69 N70 Q86 R10 R13 K14 K33 K36 K37 A40 C41 N42 Q58
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0008135 translation factor activity, RNA binding
GO:0043024 ribosomal small subunit binding
Biological Process
GO:0006412 translation
GO:0006413 translational initiation
GO:0006446 regulation of translational initiation
GO:1905746 positive regulation of mRNA cis splicing, via spliceosome
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016282 eukaryotic 43S preinitiation complex
GO:0033290 eukaryotic 48S preinitiation complex
GO:0043614 multi-eIF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zmw, PDBe:6zmw, PDBj:6zmw
PDBsum6zmw
PubMed32883864
UniProtP41567|EIF1_HUMAN Eukaryotic translation initiation factor 1 (Gene Name=EIF1)

[Back to BioLiP]