Structure of PDB 6ypu Chain p

Receptor sequence
>6ypup (length=88) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
ALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHH
SRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR
3D structure
PDB6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Chainp
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p R8 D21 T22 G23 Q28 H42 H46 H48 D49 H51 S52 R54 G55 N61 Y69 K73 R7 D20 T21 G22 Q27 H41 H45 H47 D48 H50 S51 R53 G54 N60 Y68 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum6ypu
PubMed32857965
UniProtD0CAU9

[Back to BioLiP]