Structure of PDB 6xkz Chain p

Receptor sequence

>6xkzp (length=254) Species: 272942 (Rhodobacter capsulatus SB 1003)

TTGHSWDGIEELNTPLPRWWLWTFYATIVWGVAYSIAMPAATPGILGSST
RADVEKDIAKFAEMNKAVEDKLVATDLTAIAADPELVTYTRNAGAAVFRT
WCAQCHGAGAGGNTGFPSLLDGDWLHGGSIETIYTNIKHGIMPAHLTDEL
LEPAQIDDVVQYVLKISGQPADEARATAGQQVFADNCVSCHGEDAKGMVE
MGAPNLTDGIWLYGGDANTITTTIQLGRGGVMPSWSWAAAQIRAVASYVH
SLGG

3D structure

• PDB: 6xkz Cryo-EM structures of engineered active bc 1 -cbb 3 type CIII 2 CIV super-complexes and electronic communication between the complexes.
• Chain: p
• Resolution: 7.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEC	p	M174 P175 H177 C219 C222 H223 G234 A235 P236 Y245 I256 R260 G262	M142 P143 H145 C187 C190 H191 G202 A203 P204 Y213 I224 R228 G230
BS02	HEC	p	C121 C124 H125 F135 P136 W143 L144 H145 N155 I156 I160 V263 M264 P265 W267	C102 C105 H106 F116 P117 W124 L125 H126 N136 I137 I141 V231 M232 P233 W235

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:6xkz, PDBe:6xkz, PDBj:6xkz
• PDBsum: 6xkz
• PubMed: 33568648
• UniProt: D5ARP7|CCOP_RHOCB Cbb3-type cytochrome c oxidase subunit CcoP (Gene Name=ccoP);
  Q05389|CYCY_RHOCB Cytochrome c-type cyt cy (Gene Name=cycY)