Structure of PDB 6tpq Chain p

Receptor sequence
>6tpqp (length=54) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNG
KDIN
3D structure
PDB6tpq Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainp
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p A2 V3 P4 F5 R6 R7 S9 K10 M11 K12 K13 L15 R16 R17 T18 H19 K37 H40 R41 Y49 A1 V2 P3 F4 R5 R6 S8 K9 M10 K11 K12 L14 R15 R16 T17 H18 K36 H39 R40 Y48
BS02 ZN p C30 C33 C43 C46 C29 C32 C42 C45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tpq, PDBe:6tpq, PDBj:6tpq
PDBsum6tpq
PubMed32991829
UniProtO34687|RL32_BACSU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]