Structure of PDB 6tnn Chain p

Receptor sequence
>6tnnp (length=54) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
AVPFRRTSKMKKRLRRTHFKLNVPGMTECPSCGEMKLSHRVCKACGSYNG
KDIN
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainp
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p A2 V3 P4 F5 R6 R7 T8 S9 K10 K12 K13 R16 R17 T18 H19 T28 H40 Y49 A1 V2 P3 F4 R5 R6 T7 S8 K9 K11 K12 R15 R16 T17 H18 T27 H39 Y48
BS02 ZN p C30 C43 C46 C29 C42 C45
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtO34687|RL32_BACSU Large ribosomal subunit protein bL32 (Gene Name=rpmF)

[Back to BioLiP]