Structure of PDB 6snt Chain p

Receptor sequence

>6sntp (length=218) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 6snt RQT complex dissociates ribosomes collided on endogenous RQC substrate SDD1.
• Chain: p
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	Y11 K202 G204 L206	Y10 K201 G203 L205
BS02	rna	p	R3 R4 A6 R7 C8 R10 K13 N14 K15 P16 Y22 R24 K30 K39 K40 E63 A64 A67 R90 H92 F94 R98 N100 C105 D109 Q112 Q113 M115 R116 A118 W119 Q133 R154 Y157 K158 P160 D193 G194 F196 K198	R2 R3 A5 R6 C7 R9 K12 N13 K14 P15 Y21 R23 K29 K38 K39 E62 A63 A66 R89 H91 F93 R97 N99 C104 D108 Q111 Q112 M114 R115 A117 W118 Q132 R153 Y156 K157 P159 D192 G193 F195 K197
BS03	rna	p	R110 L111	R109 L110

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6snt, PDBe:6snt, PDBj:6snt
• PDBsum: 6snt
• PubMed: 32203490
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)