Structure of PDB 5zlu Chain p

Receptor sequence

>5zlup (length=110) Species: 300852 (Thermus thermophilus HB8)

MEAKAIARYVRISPRKVRLVVDLIRGKSLEEARNILRYTNKRGAYFVAKV
LESAAANAVNNHDMLEDRLYVKAAYVDEGPALKRVLPRARGRADIIKKRT
SHITVILGEK

3D structure

• PDB: 5zlu Ribosome protection by antibiotic resistance ATP-binding cassette protein.
• Chain: p
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	I6 R8 R11 S13 K16 R18 R25 K41 R42 S53 N60 N61 R84 P87 A89 R90 G91 K98	I6 R8 R11 S13 K16 R18 R25 K41 R42 S53 N60 N61 R84 P87 A89 R90 G91 K98

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5zlu, PDBe:5zlu, PDBj:5zlu
• PDBsum: 5zlu
• PubMed: 29712846
• UniProt: Q5SHP3|RL22_THET8 Large ribosomal subunit protein uL22 (Gene Name=rplV)