Structure of PDB 5ylz Chain p

Receptor sequence

>5ylzp (length=81) Species: 559292 (Saccharomyces cerevisiae S288C)

TLYVSQLNEKINMQRLRVNLFLLFATFGEVVSMNFKKQRGQAFITMRTID
QASLAQISLNGERFFGKPLKVEFSKSETKTL

3D structure

• PDB: 5ylz Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
• Chain: p
• Resolution: 3.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	Y31 Q34 K38 V61 S62 M63 N64 K67 R69 Q71 F73 K97 S104 K105 S106 E107 T108 K109	Y3 Q6 K10 V31 S32 M33 N34 K37 R39 Q41 F43 K67 S74 K75 S76 E77 T78 K79

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0030620 U2 snRNA binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005686 U2 snRNP
• GO:0071004 U2-type prespliceosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5ylz, PDBe:5ylz, PDBj:5ylz
• PDBsum: 5ylz
• PubMed: 29153833
• UniProt: P40567|MSL1_YEAST U2 small nuclear ribonucleoprotein B'' (Gene Name=MSL1)