Structure of PDB 5nrl Chain p

Receptor sequence

>5nrlp (length=77) Species: 4932 (Saccharomyces cerevisiae)

MVPPINCIFNFLQQQTPVTIWLFEQIGIRIKGKIVGFDEFMNVVIDEAVE
IPVNVEKGTPLGKILLKGDNITLITSA

3D structure

• PDB: 5nrl Structure of a pre-catalytic spliceosome.
• Chain: p
• Resolution: 7.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	p	F32 E33 F49 M50 N51	F23 E24 F40 M41 N42

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:1990935 splicing factor binding

Biological Process

• GO:0000245 spliceosomal complex assembly
• GO:0000387 spliceosomal snRNP assembly
• GO:0000395 mRNA 5'-splice site recognition
• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing
• GO:0036261 7-methylguanosine cap hypermethylation
• GO:1903241 U2-type prespliceosome assembly

Cellular Component

• GO:0000243 commitment complex
• GO:0005634 nucleus
• GO:0005681 spliceosomal complex
• GO:0005682 U5 snRNP
• GO:0005685 U1 snRNP
• GO:0005686 U2 snRNP
• GO:0005687 U4 snRNP
• GO:0005737 cytoplasm
• GO:0032991 protein-containing complex
• GO:0034715 pICln-Sm protein complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071001 U4/U6 snRNP
• GO:0071004 U2-type prespliceosome
• GO:0071011 precatalytic spliceosome

External links

• PDB: RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
• PDBsum: 5nrl
• PubMed: 28530653
• UniProt: Q12330|RUXE_YEAST Small nuclear ribonucleoprotein E (Gene Name=SME1)