Structure of PDB 5jcs Chain p

Receptor sequence
>5jcsp (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA
3D structure
PDB5jcs Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
Chainp
Resolution9.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p G9 I10 G12 K13 Y14 G15 V16 R17 Y18 G19 S20 G50 G8 I9 G11 K12 Y13 G14 V15 R16 Y17 G18 S19 G49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0046872 metal ion binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0044391 ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5jcs, PDBe:5jcs, PDBj:5jcs
PDBsum5jcs
PubMed26619264
UniProtP0CX25|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)

[Back to BioLiP]