Structure of PDB 5imq Chain p

Receptor sequence
>5imqp (length=94) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEGLI
3D structure
PDB5imq Structure of the GTP Form of Elongation Factor 4 (EF4) Bound to the Ribosome
Chainp
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p T3 A4 Y5 S14 K16 K25 T35 K36 T37 E38 N41 K53 N55 L57 H58 K62 K63 K64 L66 R68 Y69 G71 K72 P74 D75 K78 T1 A2 Y3 S12 K14 K23 T33 K34 T35 E36 N39 K51 N53 L55 H56 K60 K61 K62 L64 R66 Y67 G69 K70 P72 D73 K76
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5imq, PDBe:5imq, PDBj:5imq
PDBsum5imq
PubMed27137929
UniProtQ5SHP0|RL23_THET8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]