Structure of PDB 4v4i Chain p

Receptor sequence
>4v4ip (length=88) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHH
SHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
3D structure
PDB4v4i Crystal Structure of a 70S Ribosome-tRNA Complex Reveals Functional Interactions and Rearrangements
Chainp
Resolution3.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna p R64 G89 R63 G88
BS02 rna p P2 D21 T22 G23 S24 T25 V27 Q28 L31 R35 L39 H42 H46 K48 D49 H51 S52 G55 L56 M59 R65 L66 R68 Y69 R72 P1 D20 T21 G22 S23 T24 V26 Q27 L30 R34 L38 H41 H45 K47 D48 H50 S51 G54 L55 M58 R64 L65 R67 Y68 R71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4i, PDBe:4v4i, PDBj:4v4i
PDBsum4v4i
PubMed16962654
UniProtQ5SJ76|RS15_THET8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]