Structure of PDB 4ne1 Chain p

Receptor sequence
>4ne1p (length=74) Species: 9606 (Homo sapiens) [Search protein sequence]
SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQA
QAEDALRVDVDQLEKVLPQLLLDF
3D structure
PDB4ne1 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
Chainp
Resolution6.499 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna p H20 K29 V30 S31 H13 K22 V23 S24
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
Biological Process
GO:0000712 resolution of meiotic recombination intermediates
GO:0006281 DNA repair
GO:0007059 chromosome segregation
GO:0031297 replication fork processing
GO:0031398 positive regulation of protein ubiquitination
GO:0036297 interstrand cross-link repair
GO:0051301 cell division
GO:0051382 kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0043240 Fanconi anaemia nuclear complex
GO:0071821 FANCM-MHF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ne1, PDBe:4ne1, PDBj:4ne1
PDBsum4ne1
PubMed24390579
UniProtA8MT69|CENPX_HUMAN Centromere protein X (Gene Name=CENPX)

[Back to BioLiP]