Structure of PDB 8ipb Chain oa

Receptor sequence

>8ipboa (length=136) Species: 4565 (Triticum aestivum)

AGEEFQHILRVLNTNVDGKQKIMFALTSIKGVGRRFSNIVCKKADIDMNK
RAGELSAEEMDRLMAVVHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVD
MKLRDDLERLKKIRNHRGLRHYWGVRVRGQHTKTTG

3D structure

• PDB: 8ipb Boric acid intercepts 80S ribosome migration from AUG-stop by stabilizing eRF1.
• Chain: oa
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	oa	Q24 K25 F28 G35 V36 G37 R38 R39 F40 R55 W82 F83 N85 R86 K87 K88 D110 H120 R124 H125 V129 R130 V131 R132 G133 Q134 H135 T136 K137 T138 T139	Q20 K21 F24 G31 V32 G33 R34 R35 F36 R51 W78 F79 N81 R82 K83 K84 D106 H116 R120 H121 V125 R126 V127 R128 G129 Q130 H131 T132 K133 T134 T135

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8ipb, PDBe:8ipb, PDBj:8ipb
• PDBsum: 8ipb
• PubMed: 38267667
• UniProt: Q8L806