Structure of PDB 5tga Chain o7

Receptor sequence

>5tgao7 (length=87) Species: 4932 (Saccharomyces cerevisiae)

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

• PDB: 5tga Molecular insights into protein synthesis with proline residues.
• Chain: o7
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o7	G2 K3 G4 T5 P6 S7 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 Q30 K31 S35 S36 A42 K43 R45 Y47 N48 W49 K52 A53 R55 R56 T59 K75	G1 K2 G3 T4 P5 S6 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 Q29 K30 S34 S35 A41 K42 R44 Y46 N47 W48 K51 A52 R54 R55 T58 K74
BS02	rna	o7	T17 R21 C22 G23 V29 K32 T59 G60 G62 R63 M64 R65 Y66 L67 K68 S71 R72 F74 K75 N76 Q79 G81 S82 A83 K85	T16 R20 C21 G22 V28 K31 T58 G59 G61 R62 M63 R64 Y65 L66 K67 S70 R71 F73 K74 N75 Q78 G80 S81 A82 K84
BS03	MG	o7	K14 S15	K13 S14
BS04	OHX	o7	K85 S87	K84 S86
BS05	ZN	o7	C19 C22 C34 C37	C18 C21 C33 C36
BS06	OHX	o7	G60 G62	G59 G61
BS07	MG	o7	G2 G4 P6	G1 G3 P5

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000448 cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tga, PDBe:5tga, PDBj:5tga
• PDBsum: 5tga
• PubMed: 27827794
• UniProt: P49166|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)