Structure of PDB 5tga Chain o5

Receptor sequence

>5tgao5 (length=119) Species: 4932 (Saccharomyces cerevisiae)

AGVKAYELRTKSKEQLASQLVDLKKELAELKVQKLSRPSLPKIKTVRKSI
ACVLTVINEQQREAVRQLYKGKKYQPKDLRAKKTRALRRALTKFEASQVT
EKQRKKQIAFPQRKYAIKA

3D structure

• PDB: 5tga Molecular insights into protein synthesis with proline residues.
• Chain: o5
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o5	K74 Y75 R81 R86 T93 K94 F95 K103 K106 I109 K115	K73 Y74 R80 R85 T92 K93 F94 K102 K105 I108 K114
BS02	rna	o5	A6 Y7 R10 S40 L41 P42 K45 K49 A52 C53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89	A5 Y6 R9 S39 L40 P41 K44 K48 A51 C52 L54 T55 N58 R62 K77 R80 A81 K82 T84 R85 R88
BS03	MG	o5	T85 L88	T84 L87

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5tga, PDBe:5tga, PDBj:5tga
• PDBsum: 5tga
• PubMed: 27827794
• UniProt: P0CX84|RL35A_YEAST Large ribosomal subunit protein uL29A (Gene Name=RPL35A)